PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT06211
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 247aa    MW: 26831.8 Da    PI: 4.7632
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT06211genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.8e-162366146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg ++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++
         EMT06211 23 RGCFSQQEEDHIVALHQILGNR-WSQIASHLP-GRTDNEIKNFWNS 66
                     899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500903.95117IPR017877Myb-like domain
SuperFamilySSF466891.41E-20277IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-4316IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-251772IPR009057Homeodomain-like
PROSITE profilePS5129423.911872IPR017930Myb domain
SMARTSM007172.5E-132270IPR001005SANT/Myb domain
PfamPF002497.2E-142366IPR001005SANT/Myb domain
CDDcd001672.43E-102665No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MPRGCGKSCR LRWINYLRPD LKRGCFSQQE EDHIVALHQI LGNRWSQIAS HLPGRTDNEI  60
KNFWNSCIKK KLRQQGIDPA THKPMAAADT ATAPLPDPEE EDRKPLSAAV GGSLAPKQPA  120
VFDPFPVCAD YGGGFAHGLG AENAAALYGQ LVGCKEGADD DAGFGGADYS SVLDVSENLG  180
YGESSSNSSN WNYGGEVGSV LDGEVPHWGK ADMEQQHTPL EHKLSLPCQE QSLLASFDFN  240
LELEPYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-2057241108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0669460.0KM066946.1 Triticum aestivum R2R3-MYB transcription factor (MYB86) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961344.11e-100PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-142MYB3_HORVU; Myb-related protein Hv33
TrEMBLM8ANW60.0M8ANW6_AEGTA; Myb-related protein Hv33
STRINGSi022730m1e-100(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.31e-43myb domain protein 55